PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc05116.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 647aa    MW: 69049.4 Da    PI: 8.2607
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc05116.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.58.4e-22129184156
                                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   +++ +++t++q++eLe++F+++++p++++r eL+k+l+L+ rqVk+WFqNrR+++k
  Zmw_sc05116.1.g00020.1.am.mk 129 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSKRLNLESRQVKFWFQNRRTQMK 184
                                   688999***********************************************999 PP

2START61.91.9e-2048656893164
                                   EEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE........-TTS--...-TTSEE-EESSEEEEEEEECTCEE CS
                         START  93 lmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd........seqkppe..sssvvRaellpSgiliepksnghs 162
                                   +m aelq+lsplvp R++vf+R+++q+ +g w++vdvSvd        ++ + p+   ++++ ++llpSg++++++ ng+s
  Zmw_sc05116.1.g00020.1.am.mk 486 QMHAELQVLSPLVPiREVVFLRFCKQHAEGLWAVVDVSVDailrpdgpQRHNHPSggAAGYMGCRLLPSGCIVQDMNNGYS 566
                                   799************************************95554444323333336999********************** PP

                                   EE CS
                         START 163 kv 164
                                   kv
  Zmw_sc05116.1.g00020.1.am.mk 567 KV 568
                                   *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.8E-23111187IPR009057Homeodomain-like
SuperFamilySSF466891.03E-21116186IPR009057Homeodomain-like
PROSITE profilePS5007118.253126186IPR001356Homeobox domain
SMARTSM003898.7E-20127190IPR001356Homeobox domain
PfamPF000462.8E-19129184IPR001356Homeobox domain
CDDcd000863.78E-20129186No hitNo description
PROSITE patternPS000270161184IPR017970Homeobox, conserved site
PROSITE profilePS5084821.835333568IPR002913START domain
SuperFamilySSF559611.51E-11485568No hitNo description
PfamPF018523.4E-15486568IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 647 aa     Download sequence    Send to blast
MSFGGMFDGS GVFSYDAGGG GSGTHNPGQF TPAPPHIPKP GGGFASPGLS LGLVVLDFLQ  60
TNMEGGQLGD VSRLGLMGSG GSGSLGDGDS LGRSAREDEN DSRSGSDNLD GASGDDLDPD  120
NGNPRQKKKK RYHRHTPQQI QELEAVFKEC PHPDEKQRME LSKRLNLESR QVKFWFQNRR  180
TQMKTQIERH ENALLRQEND KLRADNMTIR EAMRNPMCAS CGGAAVLGEV SLEEQHLRIE  240
NARLKDELDR VCALAAKFLG RPISSGSPVS LLQGCSGLEL GVGTNGFGLG LLGAPSLPPI  300
PDLMGGPVGS SALRLPVGIG GLDAGAMHGG AADGVDRTVL LELGLAAMEE LVKLSQIDEP  360
LWLPGPDGSS GFDTLNLDEY HRAFARVFGP SPAGYVSEAT REAGVAITSS IDLVDSLMDA  420
ISVVAVSLKK KARASTTDII SSGMGGTRSG SIQLVSCLAT SPSRNETLEN SRAISPRNAM  480
MWKRMQMHAE LQVLSPLVPI REVVFLRFCK QHAEGLWAVV DVSVDAILRP DGPQRHNHPS  540
GGAAGYMGCR LLPSGCIVQD MNNGYSKVPA CGGHSARVTR AFSTRRPRST AQYFMLLRVR  600
ACRVVRGGYV CEVVSSPPRP ARSAPWRPAR CARVNAIVAS ARAQTWV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462701.10.0hypothetical protein SORBIDRAFT_02g030470
SwissprotQ7Y0V70.0ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLC5X6400.0C5X640_SORBI; Putative uncharacterized protein Sb02g030470
STRINGSb02g030470.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116